SCOP 1.73: Domain d2grlc1: 2grl C:1-69

Lineage for d2grlc1 (2grl C:1-69)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (13 families)

5. Family a.35.1.11: PrgX N-terminal domain-like [140526] (1 protein)
   Part of Pfam PF01381

6. Protein PrgX [140527] (1 species)
   possibly involved in pheromone-inducible conjugation

7. Species Enterococcus faecalis [TaxId:1351] [140528] (6 PDB entries)

8. Domain d2grlc1: 2grl C:1-69 [135564]
   Other proteins in same PDB: d2grla2, d2grlb2, d2grlc2, d2grld2
   automatically matched to 2AW6 A:1-69

Details for d2grlc1

PDB Entry: 2grl, 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex

PDB Compounds: (C:) PrgX

SCOP Domain Sequences for d2grlc1:

Sequence; same for both SEQRES and ATOM records:

>d2grlc1 a.35.1.11 (C:1-69) PrgX {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnragmnt

Timeline for d2grlc1:

• d2grlc1 is new in SCOP 1.73
  
• d2grlc1 appears in SCOP 1.75
  
• d2grlc1 appears in the current release, SCOPe 2.08