![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (9 families) ![]() |
![]() | Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins) |
![]() | Protein automated matches [254479] (1 species) not a true protein |
![]() | Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries) |
![]() | Domain d2grlb2: 2grl B:67-286 [135563] Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1 automated match to d2awia2 |
PDB Entry: 2grl (more details), 3 Å
SCOPe Domain Sequences for d2grlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grlb2 a.118.8.4 (B:67-286) automated matches {Enterococcus faecalis [TaxId: 1351]} mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl tdknidsylnavniinifkiigkedihrslveeltkisak
Timeline for d2grlb2: