Lineage for d2grlb2 (2grl B:67-286)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010681Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2010849Family a.118.8.4: PrgX C-terminal domain-like [140848] (2 proteins)
  6. 2010878Protein automated matches [254479] (1 species)
    not a true protein
  7. 2010879Species Enterococcus faecalis [TaxId:1351] [255040] (5 PDB entries)
  8. 2010882Domain d2grlb2: 2grl B:67-286 [135563]
    Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1
    automated match to d2awia2

Details for d2grlb2

PDB Entry: 2grl (more details), 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex
PDB Compounds: (B:) PrgX

SCOPe Domain Sequences for d2grlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grlb2 a.118.8.4 (B:67-286) automated matches {Enterococcus faecalis [TaxId: 1351]}
mntksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynie
vptfnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdy
dltiqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfl
tdknidsylnavniinifkiigkedihrslveeltkisak

SCOPe Domain Coordinates for d2grlb2:

Click to download the PDB-style file with coordinates for d2grlb2.
(The format of our PDB-style files is described here.)

Timeline for d2grlb2: