Lineage for d2grlb2 (2grl B:70-286)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647284Superfamily a.118.8: TPR-like [48452] (4 families) (S)
  5. 647383Family a.118.8.4: PrgX C-terminal domain-like [140848] (1 protein)
  6. 647384Protein PrgX [140849] (1 species)
  7. 647385Species Enterococcus faecalis [TaxId:1351] [140850] (6 PDB entries)
  8. 647417Domain d2grlb2: 2grl B:70-286 [135563]
    Other proteins in same PDB: d2grla1, d2grlb1, d2grlc1, d2grld1
    automatically matched to 2AW6 A:70-287

Details for d2grlb2

PDB Entry: 2grl (more details), 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex
PDB Compounds: (B:) PrgX

SCOP Domain Sequences for d2grlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grlb2 a.118.8.4 (B:70-286) PrgX {Enterococcus faecalis [TaxId: 1351]}
ksvnetgkeklliskiftnpdlfdknfqriepkrltslqyfsiylgyisiahhynievpt
fnktitsdlkhlydkrttffgidyeivsnllnvlpyeevssiikpmypivdsfgkdydlt
iqtvlknaltisimnrnlkeaqyyinqfehlktiknisingyydleinylkqiyqfltdk
nidsylnavniinifkiigkedihrslveeltkisak

SCOP Domain Coordinates for d2grlb2:

Click to download the PDB-style file with coordinates for d2grlb2.
(The format of our PDB-style files is described here.)

Timeline for d2grlb2: