Class a: All alpha proteins [46456] (290 folds) |
Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily) core: 4 helices; folded leaf, closed |
Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) |
Family a.35.1.0: automated matches [191534] (1 protein) not a true family |
Protein automated matches [190907] (21 species) not a true protein |
Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries) |
Domain d2grlb1: 2grl B:1-66 [135562] Other proteins in same PDB: d2grla2, d2grlb2, d2grlc2, d2grld2 automated match to d2awia1 |
PDB Entry: 2grl (more details), 3 Å
SCOPe Domain Sequences for d2grlb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2grlb1 a.35.1.0 (B:1-66) automated matches {Enterococcus faecalis [TaxId: 1351]} mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe ilnrag
Timeline for d2grlb1: