Lineage for d2grla1 (2grl A:1-66)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.0: automated matches [191534] (1 protein)
    not a true family
  6. Protein automated matches [190907] (21 species)
    not a true protein
  7. Species Enterococcus faecalis [TaxId:1351] [255039] (5 PDB entries)
  8. Domain d2grla1: 2grl A:1-66 [135560]
    Other proteins in same PDB: d2grla2, d2grlb2, d2grlc2, d2grld2
    automated match to d2awia1

Details for d2grla1

PDB Entry: 2grl (more details), 3 Å

PDB Description: Crystal structure of dCT/iCF10 complex
PDB Compounds: (A:) PrgX

SCOPe Domain Sequences for d2grla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grla1 a.35.1.0 (A:1-66) automated matches {Enterococcus faecalis [TaxId: 1351]}
mfkigsvlkqirqelnyhqidlysgimsksvyikveadsrpisveelskfserlgvnffe
ilnrag

SCOPe Domain Coordinates for d2grla1 are not available.

Timeline for d2grla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2grla2
View in 3D
Domains from other chains:
(mouse over for more information)
d2grlb1, d2grlb2, d2grlc1, d2grlc2, d2grld1, d2grld2