Lineage for d2gred1 (2gre D:74-186)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803679Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 803858Superfamily b.49.3: Aminopeptidase/glucanase lid domain [101821] (1 family) (S)
  5. 803859Family b.49.3.1: Aminopeptidase/glucanase lid domain [101822] (7 proteins)
  6. 803868Protein Deblocking aminopeptidase YhfE [141387] (1 species)
  7. 803869Species Bacillus cereus [TaxId:1396] [141388] (1 PDB entry)
    Uniprot Q81HB5 74-186
    BC0901
  8. 803873Domain d2gred1: 2gre D:74-186 [135534]
    Other proteins in same PDB: d2grea2, d2greb2, d2grec2, d2gred2, d2gree2, d2gref2, d2greg2, d2greh2, d2grei2, d2grej2, d2grek2, d2grel2, d2grem2, d2gren2, d2greo2, d2grep2
    automatically matched to 2GRE A:74-186
    complexed with so4

Details for d2gred1

PDB Entry: 2gre (more details), 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus
PDB Compounds: (D:) Deblocking aminopeptidase

SCOP Domain Sequences for d2gred1:

Sequence, based on SEQRES records: (download)

>d2gred1 b.49.3.1 (D:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmhqtsvhvykdage
akrdeknievridervfsadevrelgievgdfvsfdprvqitesgyiksrhld

Sequence, based on observed residues (ATOM records): (download)

>d2gred1 b.49.3.1 (D:74-186) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
gamvkeikpdgrlslsmiggfrwnsvegeyceietssgktytgtilmnievridervfsa
devrelgievgdfvsfdprvqitesgyiksrhld

SCOP Domain Coordinates for d2gred1:

Click to download the PDB-style file with coordinates for d2gred1.
(The format of our PDB-style files is described here.)

Timeline for d2gred1: