Lineage for d2grea2 (2gre A:3-73,A:187-348)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 837609Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 838036Superfamily c.56.5: Zn-dependent exopeptidases [53187] (9 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 838193Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 838248Protein Deblocking aminopeptidase YhfE [142512] (1 species)
    contains insert beta-barrel domain
  7. 838249Species Bacillus cereus [TaxId:1396] [142513] (1 PDB entry)
    Uniprot Q81HB5 3-73,187-348
    BC0901
  8. 838250Domain d2grea2: 2gre A:3-73,A:187-348 [135529]
    Other proteins in same PDB: d2grea1, d2greb1, d2grec1, d2gred1, d2gree1, d2gref1, d2greg1, d2greh1, d2grei1, d2grej1, d2grek1, d2grel1, d2grem1, d2gren1, d2greo1, d2grep1
    complexed with so4

Details for d2grea2

PDB Entry: 2gre (more details), 2.65 Å

PDB Description: Crystal structure of Deblocking aminopeptidase from Bacillus cereus
PDB Compounds: (A:) Deblocking aminopeptidase

SCOP Domain Sequences for d2grea2:

Sequence, based on SEQRES records: (download)

>d2grea2 c.56.5.4 (A:3-73,A:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
hhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaq
hrlltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneeigyggnsnipeet
veylavdmgalgdgqasdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyy
gsdasaairagfdvkhaligagidsshaferthessiahtealvyayvmsnlie

Sequence, based on observed residues (ATOM records): (download)

>d2grea2 c.56.5.4 (A:3-73,A:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]}
hhtketmelikelvsipspsgntakiinfienyvsewnvetkrnnkgaliltvkgkndaq
hrlltahvdtlXdkvsvaillklikrlqdenvtlpytthflisnneggnsnipeetveyl
avdmgalgdgsdeytvsicakdssgpyhyalrkhlvelaktnhieykvdiypyyragfdv
khaligagidsshaferthessiahtealvyayvmsnlie

SCOP Domain Coordinates for d2grea2:

Click to download the PDB-style file with coordinates for d2grea2.
(The format of our PDB-style files is described here.)

Timeline for d2grea2: