| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) ![]() bacterial filament proteins |
| Family d.24.1.4: YadA C-terminal domain-like [143107] (1 protein) Pfam PF03895; trimerizes with the formation of closed beta-barrel (n=12, S=12), wrapped around triple parallel coiled coil |
| Protein Adhesin Hia [143108] (1 species) |
| Species Haemophilus influenzae [TaxId:727] [143109] (2 PDB entries) Uniprot Q48152 1022-1098! Uniprot Q48152 998-1098 |
| Domain d2gr8e2: 2gr8 E:1022-1098 [135526] Other proteins in same PDB: d2gr8a2, d2gr8b3, d2gr8c3, d2gr8d3, d2gr8e3, d2gr8f3 automated match to d2gr8a1 |
PDB Entry: 2gr8 (more details), 2 Å
SCOPe Domain Sequences for d2gr8e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gr8e2 d.24.1.4 (E:1022-1098) Adhesin Hia {Haemophilus influenzae [TaxId: 727]}
kradagtasalaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgt
tnsqgktgvaagvgyqw
Timeline for d2gr8e2: