SCOPe 2.06: Domain d2gr8e2: 2gr8 E:1022-1098

Lineage for d2gr8e2 (2gr8 E:1022-1098)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.4: YadA C-terminal domain-like [143107] (1 protein)
   Pfam PF03895; trimerizes with the formation of closed beta-barrel (n=12, S=12), wrapped around triple parallel coiled coil

6. Protein Adhesin Hia [143108] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [143109] (2 PDB entries)
   Uniprot Q48152 1022-1098! Uniprot Q48152 998-1098

8. Domain d2gr8e2: 2gr8 E:1022-1098 [135526]
   Other proteins in same PDB: d2gr8a2, d2gr8b3, d2gr8c3, d2gr8d3, d2gr8e3, d2gr8f3
   automated match to d2gr8a1

Details for d2gr8e2

PDB Entry: 2gr8, 2 Å

PDB Description: hia 1022-1098

PDB Compounds: (E:) adhesin

SCOPe Domain Sequences for d2gr8e2:

Sequence; same for both SEQRES and ATOM records:

>d2gr8e2 d.24.1.4 (E:1022-1098) Adhesin Hia {Haemophilus influenzae [TaxId: 727]}
kradagtasalaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgt
tnsqgktgvaagvgyqw

Timeline for d2gr8e2:

• d2gr8e2 first appeared in SCOP 1.73, called d2gr8e1
  
• d2gr8e2 was called d2gr8e_ in SCOPe 2.05
  
• d2gr8e2 appears in SCOPe 2.07
  
• d2gr8e2 appears in the current release, SCOPe 2.08