SCOP 1.73: Domain d2gr8c1: 2gr8 C:1022-1098

Lineage for d2gr8c1 (2gr8 C:1022-1098)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (4 families)
   bacterial filament proteins

5. Family d.24.1.4: YadA C-terminal domain-like [143107] (1 protein)
   Pfam PF03895; trimerizes with the formation of closed beta-barrel (n=12, S=12), wrapped around triple parallel coiled coil

6. Protein Adhesin Hia [143108] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [143109] (2 PDB entries)

8. Domain d2gr8c1: 2gr8 C:1022-1098 [135524]
   automatically matched to 2GR8 A:1022-1098

Details for d2gr8c1

PDB Entry: 2gr8, 2 Å

PDB Description: hia 1022-1098

PDB Compounds: (C:) adhesin

SCOP Domain Sequences for d2gr8c1:

Sequence; same for both SEQRES and ATOM records:

>d2gr8c1 d.24.1.4 (C:1022-1098) Adhesin Hia {Haemophilus influenzae [TaxId: 727]}
kradagtasalaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgt
tnsqgktgvaagvgyqw

Timeline for d2gr8c1:

• d2gr8c1 is new in SCOP 1.73
  
• d2gr8c1 appears in SCOP 1.75
  
• d2gr8c1 appears in the current release, SCOPe 2.08, called d2gr8c2