Lineage for d2gr8c2 (2gr8 C:1022-1098)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941191Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2941192Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2941248Family d.24.1.4: YadA C-terminal domain-like [143107] (1 protein)
    Pfam PF03895; trimerizes with the formation of closed beta-barrel (n=12, S=12), wrapped around triple parallel coiled coil
  6. 2941249Protein Adhesin Hia [143108] (1 species)
  7. 2941250Species Haemophilus influenzae [TaxId:727] [143109] (2 PDB entries)
    Uniprot Q48152 1022-1098! Uniprot Q48152 998-1098
  8. 2941259Domain d2gr8c2: 2gr8 C:1022-1098 [135524]
    Other proteins in same PDB: d2gr8a2, d2gr8b3, d2gr8c3, d2gr8d3, d2gr8e3, d2gr8f3
    automated match to d2gr8a1

Details for d2gr8c2

PDB Entry: 2gr8 (more details), 2 Å

PDB Description: hia 1022-1098
PDB Compounds: (C:) adhesin

SCOPe Domain Sequences for d2gr8c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gr8c2 d.24.1.4 (C:1022-1098) Adhesin Hia {Haemophilus influenzae [TaxId: 727]}
kradagtasalaasqlpqatmpgksmvaiagssyqgqnglaigvsrisdngkviirlsgt
tnsqgktgvaagvgyqw

SCOPe Domain Coordinates for d2gr8c2:

Click to download the PDB-style file with coordinates for d2gr8c2.
(The format of our PDB-style files is described here.)

Timeline for d2gr8c2: