Lineage for d2gr7f_ (2gr7 F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185566Fold d.24: Pili subunits [54522] (1 superfamily)
    contains very long N-terminal helix, which end is packed against beta-sheet
  4. 2185567Superfamily d.24.1: Pili subunits [54523] (8 families) (S)
    bacterial filament proteins
  5. 2185623Family d.24.1.4: YadA C-terminal domain-like [143107] (1 protein)
    Pfam PF03895; trimerizes with the formation of closed beta-barrel (n=12, S=12), wrapped around triple parallel coiled coil
  6. 2185624Protein Adhesin Hia [143108] (1 species)
  7. 2185625Species Haemophilus influenzae [TaxId:727] [143109] (2 PDB entries)
    Uniprot Q48152 1022-1098! Uniprot Q48152 998-1098
  8. 2185637Domain d2gr7f_: 2gr7 F: [135521]
    automated match to d2gr7a1
    complexed with c8e

Details for d2gr7f_

PDB Entry: 2gr7 (more details), 2.3 Å

PDB Description: Hia 992-1098
PDB Compounds: (F:) adhesin

SCOPe Domain Sequences for d2gr7f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gr7f_ d.24.1.4 (F:) Adhesin Hia {Haemophilus influenzae [TaxId: 727]}
avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg
qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw

SCOPe Domain Coordinates for d2gr7f_:

Click to download the PDB-style file with coordinates for d2gr7f_.
(The format of our PDB-style files is described here.)

Timeline for d2gr7f_: