Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.24: Pili subunits [54522] (1 superfamily) contains very long N-terminal helix, which end is packed against beta-sheet |
Superfamily d.24.1: Pili subunits [54523] (8 families) bacterial filament proteins |
Family d.24.1.4: YadA C-terminal domain-like [143107] (1 protein) Pfam PF03895; trimerizes with the formation of closed beta-barrel (n=12, S=12), wrapped around triple parallel coiled coil |
Protein Adhesin Hia [143108] (1 species) |
Species Haemophilus influenzae [TaxId:727] [143109] (2 PDB entries) Uniprot Q48152 1022-1098! Uniprot Q48152 998-1098 |
Domain d2gr7c_: 2gr7 C: [135518] automated match to d2gr7a1 complexed with c8e |
PDB Entry: 2gr7 (more details), 2.3 Å
SCOPe Domain Sequences for d2gr7c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gr7c_ d.24.1.4 (C:) Adhesin Hia {Haemophilus influenzae [TaxId: 727]} avakgvtnlagqvnnlegkvnkvgkradagtasalaasqlpqatmpgksmvaiagssyqg qnglaigvsrisdngkviirlsgttnsqgktgvaagvgyqw
Timeline for d2gr7c_: