Lineage for d2gqna1 (2gqn A:5-395)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 840449Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 840450Superfamily c.67.1: PLP-dependent transferases [53383] (9 families) (S)
  5. 840802Family c.67.1.3: Cystathionine synthase-like [53402] (16 proteins)
  6. 840847Protein Cystathionine beta-lyase, CBL [53403] (2 species)
  7. 840848Species Escherichia coli [TaxId:562] [53404] (4 PDB entries)
  8. 840853Domain d2gqna1: 2gqn A:5-395 [135511]
    automatically matched to d1cl1b_
    complexed with blp

Details for d2gqna1

PDB Entry: 2gqn (more details), 1.8 Å

PDB Description: Cystathionine Beta-Lyase (CBL) from Escherichia Coli in complex with N-Hydrazinocarbonylmethyl-2-Nitro-Benzamide
PDB Compounds: (A:) Cystathionine beta-lyase

SCOP Domain Sequences for d2gqna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gqna1 c.67.1.3 (A:5-395) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]}
kldtqlvnagrskkytlgavnsviqrasslvfdsveakkhatrnrangelfygrrgtlth
fslqqamceleggagcvlfpcgaaavansilafieqgdhvlmtntayepsqdfcskilsk
lgvttswfdpligadivkhlqpntkivflespgsitmevhdvpaivaavrsvvpdaiimi
dntwaagvlfkaldfgidvsiqaatkylvghsdamigtavcnarcweqlrenaylmgqmv
dadtayitsrglrtlgvrlrqhhesslkvaewlaehpqvarvnhpalpgskghefwkrdf
tgssglfsfvlkkklnneelanyldnfslfsmayswggyeslilanqpehiaairpqgei
dfsgtlirlhigledvddliadldagfariv

SCOP Domain Coordinates for d2gqna1:

Click to download the PDB-style file with coordinates for d2gqna1.
(The format of our PDB-style files is described here.)

Timeline for d2gqna1: