Lineage for d2gq3b_ (2gq3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088435Superfamily c.1.13: Malate synthase G [51645] (1 family) (S)
  5. 2088436Family c.1.13.1: Malate synthase G [51646] (2 protein domains)
  6. 2088437Protein Malate synthase G [51647] (3 species)
    contains the insert of all-beta (sub)domain and the C-terminal extension of all-alpha (sub)domain
  7. 2088444Species Mycobacterium tuberculosis [TaxId:1773] [82274] (3 PDB entries)
  8. 2088447Domain d2gq3b_: 2gq3 B: [135510]
    automated match to d1y8ba_
    complexed with coa, epe, mg, mlt

Details for d2gq3b_

PDB Entry: 2gq3 (more details), 2.3 Å

PDB Description: mycobacterium tuberculosis malate synthase in complex with magnesium, malate, and coenzyme a
PDB Compounds: (B:) malate synthase g

SCOPe Domain Sequences for d2gq3b_:

Sequence, based on SEQRES records: (download)

>d2gq3b_ c.1.13.1 (B:) Malate synthase G {Mycobacterium tuberculosis [TaxId: 1773]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
avdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfeg
imdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlg
lpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkg
tmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastaw
vpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnn
cqsilgyvvrwvdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvras
lermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrref
karaa

Sequence, based on observed residues (ATOM records): (download)

>d2gq3b_ c.1.13.1 (B:) Malate synthase G {Mycobacterium tuberculosis [TaxId: 1773]}
tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
lnarfalnaanarwgslydalygtdvipeaekgptynkvrgdkviayarkflddsvplss
gsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhieilid
pesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaaalr
vlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftglia
ihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigim
deerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilay
edhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlha
lhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrw
vdqgvgcskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrq
nagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraa

SCOPe Domain Coordinates for d2gq3b_:

Click to download the PDB-style file with coordinates for d2gq3b_.
(The format of our PDB-style files is described here.)

Timeline for d2gq3b_: