Lineage for d2gpwd3 (2gpw D:115-330)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734347Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 734348Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) (S)
  5. 734368Family d.142.1.2: BC ATP-binding domain-like [56067] (6 proteins)
  6. 734375Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 734378Species Escherichia coli [TaxId:562] [56069] (5 PDB entries)
  8. 734384Domain d2gpwd3: 2gpw D:115-330 [135508]
    Other proteins in same PDB: d2gpwa1, d2gpwa2, d2gpwb1, d2gpwb2, d2gpwc1, d2gpwc2, d2gpwd1, d2gpwd2
    automatically matched to d1bnca3
    mutant

Details for d2gpwd3

PDB Entry: 2gpw (more details), 2.2 Å

PDB Description: crystal structure of the biotin carboxylase subunit, f363a mutant, of acetyl-coa carboxylase from escherichia coli.
PDB Compounds: (D:) biotin carboxylase

SCOP Domain Sequences for d2gpwd3:

Sequence, based on SEQRES records: (download)

>d2gpwd3 d.142.1.2 (D:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Sequence, based on observed residues (ATOM records): (download)

>d2gpwd3 d.142.1.2 (D:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasggmrvvrgdaela
qsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkv
veeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpv
temitgvdlikeqlriaagqplsikqeevhv

SCOP Domain Coordinates for d2gpwd3:

Click to download the PDB-style file with coordinates for d2gpwd3.
(The format of our PDB-style files is described here.)

Timeline for d2gpwd3: