Class b: All beta proteins [48724] (177 folds) |
Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) |
Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
Species Escherichia coli [TaxId:562] [51249] (24 PDB entries) |
Domain d2gpwd1: 2gpw D:331-447 [135506] Other proteins in same PDB: d2gpwa2, d2gpwa3, d2gpwa4, d2gpwb2, d2gpwb3, d2gpwb4, d2gpwc2, d2gpwc3, d2gpwc4, d2gpwd2, d2gpwd3, d2gpwd4 automated match to d2w6za3 mutant |
PDB Entry: 2gpw (more details), 2.2 Å
SCOPe Domain Sequences for d2gpwd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gpwd1 b.84.2.1 (D:331-447) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]} rghavecrinaedpntflpspgkitrfhapggagvrweshiyagytvppyydsmigklic ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq
Timeline for d2gpwd1: