Lineage for d2gpwc3 (2gpw C:115-330)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. Domain d2gpwc3: 2gpw C:115-330 [135505]
    Other proteins in same PDB: d2gpwa1, d2gpwa2, d2gpwa4, d2gpwb1, d2gpwb2, d2gpwb4, d2gpwc1, d2gpwc2, d2gpwc4, d2gpwd1, d2gpwd2, d2gpwd4
    automated match to d1dv2a3
    mutant

Details for d2gpwc3

PDB Entry: 2gpw (more details), 2.2 Å

PDB Description: Crystal Structure of the Biotin Carboxylase Subunit, F363A Mutant, of Acetyl-CoA Carboxylase from Escherichia coli.
PDB Compounds: (C:) biotin carboxylase

SCOPe Domain Sequences for d2gpwc3:

Sequence, based on SEQRES records: (download)

>d2gpwc3 d.142.1.2 (C:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Sequence, based on observed residues (ATOM records): (download)

>d2gpwc3 d.142.1.2 (C:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasggmrvvrgdaela
qsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkv
veeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpv
temitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d2gpwc3 are not available.

Timeline for d2gpwc3:

Domains from same chain:
(mouse over for more information)
d2gpwc1, d2gpwc2, d2gpwc4
Domains from other chains:
(mouse over for more information)
d2gpwa1, d2gpwa2, d2gpwa3, d2gpwa4, d2gpwb1, d2gpwb2, d2gpwb3, d2gpwb4, d2gpwd1, d2gpwd2, d2gpwd3, d2gpwd4