![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
![]() | Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
![]() | Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins) |
![]() | Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
![]() | Species Escherichia coli [TaxId:562] [52443] (24 PDB entries) |
![]() | Domain d2gpwc2: 2gpw C:1-114 [135504] Other proteins in same PDB: d2gpwa1, d2gpwa3, d2gpwa4, d2gpwb1, d2gpwb3, d2gpwb4, d2gpwc1, d2gpwc3, d2gpwc4, d2gpwd1, d2gpwd3, d2gpwd4 automated match to d2gpwc2 mutant |
PDB Entry: 2gpw (more details), 2.2 Å
SCOPe Domain Sequences for d2gpwc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gpwc2 c.30.1.1 (C:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]} mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg
Timeline for d2gpwc2: