Lineage for d2gpwc1 (2gpw C:331-447)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 964158Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 964233Superfamily b.84.2: Rudiment single hybrid motif [51246] (2 families) (S)
  5. 964234Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins)
    probable rudiment form of the biotinyl-carrier domain
  6. 964241Protein Biotin carboxylase (BC), C-domain [51248] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 964244Species Escherichia coli [TaxId:562] [51249] (7 PDB entries)
  8. 964251Domain d2gpwc1: 2gpw C:331-447 [135503]
    Other proteins in same PDB: d2gpwa2, d2gpwa3, d2gpwb2, d2gpwb3, d2gpwc2, d2gpwc3, d2gpwd2, d2gpwd3
    automatically matched to d1bncb1
    mutant

Details for d2gpwc1

PDB Entry: 2gpw (more details), 2.2 Å

PDB Description: crystal structure of the biotin carboxylase subunit, f363a mutant, of acetyl-coa carboxylase from escherichia coli.
PDB Compounds: (C:) biotin carboxylase

SCOPe Domain Sequences for d2gpwc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpwc1 b.84.2.1 (C:331-447) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggagvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklglq

SCOPe Domain Coordinates for d2gpwc1:

Click to download the PDB-style file with coordinates for d2gpwc1.
(The format of our PDB-style files is described here.)

Timeline for d2gpwc1: