Lineage for d2gpwb2 (2gpw B:1-114)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2861873Family c.30.1.1: BC N-terminal domain-like [52441] (6 proteins)
  6. 2861880Protein Biotin carboxylase (BC), N-terminal domain [52442] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2861883Species Escherichia coli [TaxId:562] [52443] (24 PDB entries)
  8. 2861901Domain d2gpwb2: 2gpw B:1-114 [135501]
    Other proteins in same PDB: d2gpwa1, d2gpwa3, d2gpwa4, d2gpwb1, d2gpwb3, d2gpwb4, d2gpwc1, d2gpwc3, d2gpwc4, d2gpwd1, d2gpwd3, d2gpwd4
    automated match to d2gpwa2
    mutant

Details for d2gpwb2

PDB Entry: 2gpw (more details), 2.2 Å

PDB Description: crystal structure of the biotin carboxylase subunit, f363a mutant, of acetyl-coa carboxylase from escherichia coli.
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d2gpwb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpwb2 c.30.1.1 (B:1-114) Biotin carboxylase (BC), N-terminal domain {Escherichia coli [TaxId: 562]}
mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmg

SCOPe Domain Coordinates for d2gpwb2:

Click to download the PDB-style file with coordinates for d2gpwb2.
(The format of our PDB-style files is described here.)

Timeline for d2gpwb2: