Lineage for d2gpvc_ (2gpv C:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [81917] (24 PDB entries)
    Uniprot O75454 233-458
  8. Domain d2gpvc_: 2gpv C: [135496]
    automated match to d1tfca_
    complexed with oht

Details for d2gpvc_

PDB Entry: 2gpv (more details), 2.8499999999999996 Å

PDB Description: estrogen related receptor-gamma ligand binding domain complexed with 4-hydroxy-tamoxifen and a smrt peptide
PDB Compounds: (C:) Estrogen-related receptor gamma

SCOPe Domain Sequences for d2gpvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpvc_ a.123.1.1 (C:) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
pynkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstl
sladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailql
vkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedpr
ragkmlmtlpllrqtstkavqhfyniklegkvpmhklflemle

SCOPe Domain Coordinates for d2gpvc_ are not available.

Timeline for d2gpvc_:

Domains from other chains:
(mouse over for more information)
d2gpva_, d2gpvb_, d2gpvd_, d2gpve_, d2gpvf_