Lineage for d2gpsa3 (2gps A:115-330)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2541368Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2541369Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2541397Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2541404Protein Biotin carboxylase (BC), domain 2 [56068] (2 species)
    subunit of acetyl-CoA and pyruvate carboxylases
  7. 2541407Species Escherichia coli [TaxId:562] [56069] (24 PDB entries)
  8. 2541450Domain d2gpsa3: 2gps A:115-330 [135489]
    Other proteins in same PDB: d2gpsa1, d2gpsa2, d2gpsa4, d2gpsb1, d2gpsb2, d2gpsb4
    automated match to d1dv2a3
    mutant

Details for d2gpsa3

PDB Entry: 2gps (more details), 2.8 Å

PDB Description: Crystal Structure of the Biotin Carboxylase Subunit, E23R mutant, of Acetyl-CoA Carboxylase from Escherichia coli.
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d2gpsa3:

Sequence, based on SEQRES records: (download)

>d2gpsa3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

Sequence, based on observed residues (ATOM records): (download)

>d2gpsa3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggmrvvrgdael
aqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqk
vveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehp
vtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d2gpsa3:

Click to download the PDB-style file with coordinates for d2gpsa3.
(The format of our PDB-style files is described here.)

Timeline for d2gpsa3: