| Class b: All beta proteins [48724] (176 folds) |
| Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies) sandwich of half-barrel shaped beta-sheets |
Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) ![]() |
| Family b.84.2.1: BC C-terminal domain-like [51247] (5 proteins) probable rudiment form of the biotinyl-carrier domain |
| Protein Biotin carboxylase (BC), C-domain [51248] (2 species) subunit of acetyl-CoA and pyruvate carboxylases |
| Species Escherichia coli [TaxId:562] [51249] (24 PDB entries) |
| Domain d2gpsa1: 2gps A:331-446 [135487] Other proteins in same PDB: d2gpsa2, d2gpsa3, d2gpsb2, d2gpsb3 automated match to d2w6za3 mutant |
PDB Entry: 2gps (more details), 2.8 Å
SCOPe Domain Sequences for d2gpsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gpsa1 b.84.2.1 (A:331-446) Biotin carboxylase (BC), C-domain {Escherichia coli [TaxId: 562]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekklgl
Timeline for d2gpsa1: