Lineage for d2gplv1 (2gpl V:1-223)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 736244Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 736289Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (9 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 736341Domain d2gplv1: 2gpl V:1-223 [135479]
    Other proteins in same PDB: d2gpla1, d2gplb1, d2gplc1, d2gpld1, d2gple1, d2gplf1, d2gplg1, d2gplo1, d2gplp1, d2gplq1, d2gplr1, d2gpls1, d2gplt1, d2gplu1
    automatically matched to d1g0uh_
    complexed with biq

Details for d2gplv1

PDB Entry: 2gpl (more details), 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors
PDB Compounds: (V:) Proteasome component PUP1

SCOP Domain Sequences for d2gplv1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gplv1 d.153.1.4 (V:1-223) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

SCOP Domain Coordinates for d2gplv1:

Click to download the PDB-style file with coordinates for d2gplv1.
(The format of our PDB-style files is described here.)

Timeline for d2gplv1: