SCOPe 2.07: Domain d2gplu_: 2gpl U:

Lineage for d2gplu_ (2gpl U:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)

8. Domain d2gplu_: 2gpl U: [135478]
   Other proteins in same PDB: d2gpl1_, d2gpl2_, d2gpla_, d2gplb_, d2gplc_, d2gpld_, d2gple_, d2gplf_, d2gplh_, d2gpli_, d2gplj_, d2gplk_, d2gpll_, d2gplm_, d2gpln_, d2gplo_, d2gplp_, d2gplq_, d2gplr_, d2gpls_, d2gplt_, d2gplv_, d2gplw_, d2gplx_, d2gply_, d2gplz_
   automated match to d1g65g_
   complexed with biq

Details for d2gplu_

PDB Entry: 2gpl, 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors

PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d2gplu_:

Sequence; same for both SEQRES and ATOM records:

>d2gplu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

Timeline for d2gplu_:

• d2gplu_ first appeared in SCOP 1.73, called d2gplu1
  
• d2gplu_ appears in SCOPe 2.06
  
• d2gplu_ appears in the current release, SCOPe 2.08