Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries) |
Domain d2gplu_: 2gpl U: [135478] Other proteins in same PDB: d2gpl1_, d2gpl2_, d2gpla_, d2gplb_, d2gplc_, d2gpld_, d2gple_, d2gplf_, d2gplh_, d2gpli_, d2gplj_, d2gplk_, d2gpll_, d2gplm_, d2gpln_, d2gplo_, d2gplp_, d2gplq_, d2gplr_, d2gpls_, d2gplt_, d2gplv_, d2gplw_, d2gplx_, d2gply_, d2gplz_ automated match to d1g65g_ complexed with biq |
PDB Entry: 2gpl (more details), 2.81 Å
SCOPe Domain Sequences for d2gplu_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gplu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia eqd
Timeline for d2gplu_:
View in 3D Domains from other chains: (mouse over for more information) d2gpl1_, d2gpl2_, d2gpla_, d2gplb_, d2gplc_, d2gpld_, d2gple_, d2gplf_, d2gplg_, d2gplh_, d2gpli_, d2gplj_, d2gplk_, d2gpll_, d2gplm_, d2gpln_, d2gplo_, d2gplp_, d2gplq_, d2gplr_, d2gpls_, d2gplt_, d2gplv_, d2gplw_, d2gplx_, d2gply_, d2gplz_ |