Lineage for d2gplu_ (2gpl U:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2993333Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [187078] (41 PDB entries)
  8. 2993439Domain d2gplu_: 2gpl U: [135478]
    Other proteins in same PDB: d2gpl1_, d2gpl2_, d2gpla_, d2gplb_, d2gplc_, d2gpld_, d2gple_, d2gplf_, d2gplh_, d2gpli_, d2gplj_, d2gplk_, d2gpll_, d2gplm_, d2gpln_, d2gplo_, d2gplp_, d2gplq_, d2gplr_, d2gpls_, d2gplt_, d2gplv_, d2gplw_, d2gplx_, d2gply_, d2gplz_
    automated match to d1g65g_
    complexed with biq

Details for d2gplu_

PDB Entry: 2gpl (more details), 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors
PDB Compounds: (U:) Proteasome component C7-alpha

SCOPe Domain Sequences for d2gplu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gplu_ d.153.1.4 (U:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOPe Domain Coordinates for d2gplu_:

Click to download the PDB-style file with coordinates for d2gplu_.
(The format of our PDB-style files is described here.)

Timeline for d2gplu_: