| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
| Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
| Protein Proteasome alpha subunit (non-catalytic) [56255] (8 species) contains an extension to the common fold at the N-terminus |
| Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (193 PDB entries) The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8) |
| Domain d2gplq_: 2gpl Q: [135474] Other proteins in same PDB: d2gpl1_, d2gpl2_, d2gpld_, d2gplg_, d2gplh_, d2gpli_, d2gplj_, d2gplk_, d2gpll_, d2gplm_, d2gpln_, d2gplr_, d2gplu_, d2gplv_, d2gplw_, d2gplx_, d2gply_, d2gplz_ automated match to d1g65c_ complexed with biq |
PDB Entry: 2gpl (more details), 2.81 Å
SCOPe Domain Sequences for d2gplq_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gplq_ d.153.1.4 (Q:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
q
Timeline for d2gplq_:
View in 3DDomains from other chains: (mouse over for more information) d2gpl1_, d2gpl2_, d2gpla_, d2gplb_, d2gplc_, d2gpld_, d2gple_, d2gplf_, d2gplg_, d2gplh_, d2gpli_, d2gplj_, d2gplk_, d2gpll_, d2gplm_, d2gpln_, d2gplo_, d2gplp_, d2gplr_, d2gpls_, d2gplt_, d2gplu_, d2gplv_, d2gplw_, d2gplx_, d2gply_, d2gplz_ |