Lineage for d2gplf_ (2gpl F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2594772Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2594884Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. 2594900Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (242 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 2595117Domain d2gplf_: 2gpl F: [135463]
    Other proteins in same PDB: d2gpl1_, d2gpl2_, d2gpld_, d2gplg_, d2gplh_, d2gpli_, d2gplj_, d2gplk_, d2gpll_, d2gplm_, d2gpln_, d2gplr_, d2gplu_, d2gplv_, d2gplw_, d2gplx_, d2gply_, d2gplz_
    automated match to d1g65f_
    complexed with biq

Details for d2gplf_

PDB Entry: 2gpl (more details), 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors
PDB Compounds: (F:) Proteasome component C1

SCOPe Domain Sequences for d2gplf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gplf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d2gplf_:

Click to download the PDB-style file with coordinates for d2gplf_.
(The format of our PDB-style files is described here.)

Timeline for d2gplf_: