Lineage for d2gplf1 (2gpl F:5-241)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735943Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 736028Protein Proteasome alpha subunit (non-catalytic) [56255] (5 species)
    contains an extension to the common fold at the N-terminus
  7. 736080Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (9 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 736128Domain d2gplf1: 2gpl F:5-241 [135463]
    Other proteins in same PDB: d2gpl11, d2gpl21, d2gplh1, d2gpli1, d2gplj1, d2gplk1, d2gpll1, d2gplm1, d2gpln1, d2gplv1, d2gplw1, d2gplx1, d2gply1, d2gplz1
    automatically matched to d1g65f_
    complexed with biq

Details for d2gplf1

PDB Entry: 2gpl (more details), 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors
PDB Compounds: (F:) Proteasome component C1

SCOP Domain Sequences for d2gplf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gplf1 d.153.1.4 (F:5-241) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOP Domain Coordinates for d2gplf1:

Click to download the PDB-style file with coordinates for d2gplf1.
(The format of our PDB-style files is described here.)

Timeline for d2gplf1: