Lineage for d2gpla_ (2gpl A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
    contains an extension to the common fold at the N-terminus
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. Domain d2gpla_: 2gpl A: [135458]
    Other proteins in same PDB: d2gpl1_, d2gpl2_, d2gpld_, d2gplg_, d2gplh_, d2gpli_, d2gplj_, d2gplk_, d2gpll_, d2gplm_, d2gpln_, d2gplr_, d2gplu_, d2gplv_, d2gplw_, d2gplx_, d2gply_, d2gplz_
    automated match to d1g65a_
    complexed with biq

Details for d2gpla_

PDB Entry: 2gpl (more details), 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors
PDB Compounds: (A:) Proteasome component Y7

SCOPe Domain Sequences for d2gpla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gpla_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

SCOPe Domain Coordinates for d2gpla_ are not available.

Timeline for d2gpla_: