SCOP 1.73: Domain d2gpl21: 2gpl 2:2-18J

Lineage for d2gpl21 (2gpl 2:2-18J)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (9 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d2gpl21: 2gpl 2:2-18J [135457]
   Other proteins in same PDB: d2gpla1, d2gplb1, d2gplc1, d2gpld1, d2gple1, d2gplf1, d2gplg1, d2gplo1, d2gplp1, d2gplq1, d2gplr1, d2gpls1, d2gplt1, d2gplu1
   automatically matched to d1ryph_
   complexed with biq

Details for d2gpl21

PDB Entry: 2gpl, 2.81 Å

PDB Description: TMC-95 based biphenyl-ether macrocycles: specific proteasome inhibitors

PDB Compounds: (2:) Proteasome component PRE3

SCOP Domain Sequences for d2gpl21:

Sequence; same for both SEQRES and ATOM records:

>d2gpl21 d.153.1.4 (2:2-18J) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
simavtfkdgvilgadsrtttgayianrvtdkltrvhdkiwccrsgsaadtqaiadivqy
hlelytsqygtpstetaasvfkelcyenkdnltagiivagyddknkgevytiplggsvhk
lpyaiagsgstfiygycdknfrenmskeetvdfikhslsqaikwdgssggvirmvvltaa
gverlifypdeyeql

Timeline for d2gpl21:

• d2gpl21 is new in SCOP 1.73
  
• d2gpl21 appears in SCOP 1.75
  
• d2gpl21 appears in the current release, SCOPe 2.08, called d2gpl2_