Lineage for d2gp7c1 (2gp7 C:235-458)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647844Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 647845Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 647846Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (32 proteins)
  6. 647998Protein Orphan nuclear receptor ERR3 [81916] (1 species)
  7. 647999Species Human (Homo sapiens) [TaxId:9606] [81917] (11 PDB entries)
  8. 648015Domain d2gp7c1: 2gp7 C:235-458 [135454]
    automatically matched to d1tfca_
    complexed with ca

Details for d2gp7c1

PDB Entry: 2gp7 (more details), 2.45 Å

PDB Description: Estrogen Related Receptor-gamma ligand binding domain
PDB Compounds: (C:) Estrogen-related receptor gamma

SCOP Domain Sequences for d2gp7c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gp7c1 a.123.1.1 (C:235-458) Orphan nuclear receptor ERR3 {Human (Homo sapiens) [TaxId: 9606]}
nkivshllvaepekiyampdptvpdsdikalttlcdladrelvviigwakhipgfstlsl
adqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldlnnailqlvk
kyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra
gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv

SCOP Domain Coordinates for d2gp7c1:

Click to download the PDB-style file with coordinates for d2gp7c1.
(The format of our PDB-style files is described here.)

Timeline for d2gp7c1: