| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies) 3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology this domain is thought to be mobile in most multi-domain proteins known to contain it |
Superfamily c.8.2: LeuD/IlvD-like [52016] (4 families) ![]() contains mixed beta-sheet barrel, closed n=7, S=10 |
| Family c.8.2.2: IlvD/EDD C-terminal domain-like [141976] (1 protein) C-terminal part of Pfam PF00920 |
| Protein 6-phosphogluconate dehydratase EDD [141977] (1 species) |
| Species Shewanella oneidensis [TaxId:70863] [141978] (1 PDB entry) Uniprot Q8EEA0 419-608 |
| Domain d2gp4b1: 2gp4 B:419-608 [135450] Other proteins in same PDB: d2gp4a2, d2gp4a3, d2gp4b2, d2gp4b3 automated match to d2gp4a1 |
PDB Entry: 2gp4 (more details), 2.49 Å
SCOPe Domain Sequences for d2gp4b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gp4b1 c.8.2.2 (B:419-608) 6-phosphogluconate dehydratase EDD {Shewanella oneidensis [TaxId: 70863]}
glkllkgnlgravikvsavqpqhrvveapavviddqnkldalfksgaldrdcvvvvkgqg
pkangmpelhkltpllgslqdkgfkvalmtdgrmsgasgkvpaaihltpeaidggliakv
qdgdlirvdaltgelsllvsdtelatrtateidlrhsrygmgrelfgvlrsnlsspetga
rstsaidely
Timeline for d2gp4b1: