Lineage for d2goof_ (2goo F:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637112Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2637168Protein Type II activin receptor [57357] (3 species)
  7. 2637169Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)
  8. 2637173Domain d2goof_: 2goo F: [135446]
    Other proteins in same PDB: d2gooa_, d2goob_, d2good_, d2gooe_
    automated match to d1btea_
    complexed with ndg

Details for d2goof_

PDB Entry: 2goo (more details), 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd
PDB Compounds: (F:) Activin receptor type 2A

SCOPe Domain Sequences for d2goof_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2goof_ g.7.1.3 (F:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfp

SCOPe Domain Coordinates for d2goof_:

Click to download the PDB-style file with coordinates for d2goof_.
(The format of our PDB-style files is described here.)

Timeline for d2goof_: