SCOPe 2.05: Domain d2goof_: 2goo F:

Lineage for d2goof_ (2goo F:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein Type II activin receptor [57357] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)

8. Domain d2goof_: 2goo F: [135446]
   Other proteins in same PDB: d2gooa_, d2goob_, d2good_, d2gooe_
   automated match to d1btea_
   complexed with ndg

Details for d2goof_

PDB Entry: 2goo, 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd

PDB Compounds: (F:) Activin receptor type 2A

SCOPe Domain Sequences for d2goof_:

Sequence; same for both SEQRES and ATOM records:

>d2goof_ g.7.1.3 (F:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc
ydrtdciekkdspevyfcccegnmcnekfsyfp

Timeline for d2goof_:

• d2goof_ first appeared in SCOP 1.73, called d2goof1
  
• d2goof_ appears in SCOPe 2.04
  
• d2goof_ appears in SCOPe 2.06
  
• d2goof_ appears in the current release, SCOPe 2.08