SCOP 1.73: Domain d2goof1: 2goo F:8-99

Lineage for d2goof1 (2goo F:8-99)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)

6. Protein Type II activin receptor [57357] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)

8. Domain d2goof1: 2goo F:8-99 [135446]
   Other proteins in same PDB: d2gooa1, d2goob1, d2good1, d2gooe1
   automatically matched to d1btea_
   complexed with ndg

Details for d2goof1

PDB Entry: 2goo, 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd

PDB Compounds: (F:) Activin receptor type 2A

SCOP Domain Sequences for d2goof1:

Sequence; same for both SEQRES and ATOM records:

>d2goof1 g.7.1.3 (F:8-99) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
tqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddincy
drtdciekkdspevyfcccegnmcnekfsyfp

Timeline for d2goof1:

• d2goof1 is new in SCOP 1.73
  
• d2goof1 appears in SCOP 1.75
  
• d2goof1 appears in the current release, SCOPe 2.08, called d2goof_