![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein Type II activin receptor [57357] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries) |
![]() | Domain d2goof_: 2goo F: [135446] Other proteins in same PDB: d2gooa_, d2goob_, d2good_, d2gooe_ automated match to d1btea_ complexed with ndg |
PDB Entry: 2goo (more details), 2.2 Å
SCOPe Domain Sequences for d2goof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2goof_ g.7.1.3 (F:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]} etqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddinc ydrtdciekkdspevyfcccegnmcnekfsyfp
Timeline for d2goof_: