SCOP 1.73: Domain d2gooe1: 2goo E:34-118

Lineage for d2gooe1 (2goo E:34-118)

1. Root: SCOP 1.73

2. Class g: Small proteins [56992] (85 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (3 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (5 PDB entries)

8. Domain d2gooe1: 2goo E:34-118 [135445]
   Other proteins in same PDB: d2gooa1, d2gooc1, d2good1, d2goof1
   automatically matched to d1es7d_
   complexed with ndg

Details for d2gooe1

PDB Entry: 2goo, 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd

PDB Compounds: (E:) Bone morphogenetic protein receptor type IA

SCOP Domain Sequences for d2gooe1:

Sequence; same for both SEQRES and ATOM records:

>d2gooe1 g.7.1.3 (E:34-118) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlppv

Timeline for d2gooe1:

• d2gooe1 is new in SCOP 1.73
  
• d2gooe1 appears in SCOP 1.75
  
• d2gooe1 appears in the current release, SCOPe 2.08, called d2gooe_