![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
![]() | Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
![]() | Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
![]() | Protein BMP receptor Ia ectodomain [57359] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries) |
![]() | Domain d2gooe_: 2goo E: [135445] Other proteins in same PDB: d2gooa_, d2gooc_, d2good_, d2goof_ automated match to d3qb4d_ complexed with ndg |
PDB Entry: 2goo (more details), 2.2 Å
SCOPe Domain Sequences for d2gooe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gooe_ g.7.1.3 (E:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]} lpflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspk aqlrrtieccrtnlcnqylqptlppvvi
Timeline for d2gooe_: