![]() | Class g: Small proteins [56992] (85 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (7 families) ![]() |
![]() | Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (7 proteins) |
![]() | Protein Bone morphogenetic protein-2 (BMP-2) [57516] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [57517] (6 PDB entries) |
![]() | Domain d2good1: 2goo D:12-114 [135444] Other proteins in same PDB: d2goob1, d2gooc1, d2gooe1, d2goof1 automatically matched to d3bmpa_ complexed with ndg |
PDB Entry: 2goo (more details), 2.2 Å
SCOP Domain Sequences for d2good1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2good1 g.17.1.2 (D:12-114) Bone morphogenetic protein-2 (BMP-2) {Human (Homo sapiens) [TaxId: 9606]} ssckrhplyvdfsdvgwndwivappgyhafychgecpfpladhlnstnhaivqtlvnsvn skipkaccvptelsaismlyldenekvvlknyqdmvvegcgcr
Timeline for d2good1: