Lineage for d2gooc_ (2goo C:)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1962063Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1962064Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1962288Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 1962339Protein Type II activin receptor [57357] (3 species)
  7. 1962340Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)
  8. 1962343Domain d2gooc_: 2goo C: [135443]
    Other proteins in same PDB: d2gooa_, d2goob_, d2good_, d2gooe_
    automated match to d1btea_
    complexed with ndg

Details for d2gooc_

PDB Entry: 2goo (more details), 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd
PDB Compounds: (C:) Activin receptor type 2A

SCOPe Domain Sequences for d2gooc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gooc_ g.7.1.3 (C:) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
tqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddincy
drtdciekkdspevyfcccegnmcnekfsyfp

SCOPe Domain Coordinates for d2gooc_:

Click to download the PDB-style file with coordinates for d2gooc_.
(The format of our PDB-style files is described here.)

Timeline for d2gooc_: