| Class g: Small proteins [56992] (90 folds) |
| Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) ![]() |
| Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (7 proteins) |
| Protein automated matches [190308] (2 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [187122] (1 PDB entry) |
| Domain d2gooc_: 2goo C: [135443] Other proteins in same PDB: d2gooa_, d2goob1, d2good_, d2gooe1 automated match to d1btea_ complexed with ndg |
PDB Entry: 2goo (more details), 2.2 Å
SCOPe Domain Sequences for d2gooc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gooc_ g.7.1.3 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddincy
drtdciekkdspevyfcccegnmcnekfsyfp
Timeline for d2gooc_: