Lineage for d2gooc1 (2goo C:8-99)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 890226Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 890227Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 890414Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 890445Protein Type II activin receptor [57357] (3 species)
  7. 890446Species Mouse (Mus musculus) [TaxId:10090] [57358] (3 PDB entries)
  8. 890449Domain d2gooc1: 2goo C:8-99 [135443]
    Other proteins in same PDB: d2gooa1, d2goob1, d2good1, d2gooe1
    automatically matched to d1btea_
    complexed with ndg

Details for d2gooc1

PDB Entry: 2goo (more details), 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd
PDB Compounds: (C:) Activin receptor type 2A

SCOP Domain Sequences for d2gooc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gooc1 g.7.1.3 (C:8-99) Type II activin receptor {Mouse (Mus musculus) [TaxId: 10090]}
tqeclffnanwerdrtnqtgvepcygdkdkrrhcfatwknisgsieivkqgcwlddincy
drtdciekkdspevyfcccegnmcnekfsyfp

SCOP Domain Coordinates for d2gooc1:

Click to download the PDB-style file with coordinates for d2gooc1.
(The format of our PDB-style files is described here.)

Timeline for d2gooc1: