SCOPe 2.05: Domain d2goob_: 2goo B:

Lineage for d2goob_ (2goo B:)

1. Root: SCOPe 2.05

2. Class g: Small proteins [56992] (92 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein BMP receptor Ia ectodomain [57359] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57360] (11 PDB entries)

8. Domain d2goob_: 2goo B: [135442]
   Other proteins in same PDB: d2gooa_, d2gooc_, d2good_, d2goof_
   automated match to d3qb4d_
   complexed with ndg

Details for d2goob_

PDB Entry: 2goo, 2.2 Å

PDB Description: ternary complex of bmp-2 bound to bmpr-ia-ecd and actrii-ecd

PDB Compounds: (B:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2goob_:

Sequence; same for both SEQRES and ATOM records:

>d2goob_ g.7.1.3 (B:) BMP receptor Ia ectodomain {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlppv

Timeline for d2goob_:

• d2goob_ first appeared in SCOP 1.73, called d2goob1
  
• d2goob_ appears in SCOPe 2.04
  
• d2goob_ appears in SCOPe 2.06
  
• d2goob_ appears in the current release, SCOPe 2.08