![]() | Class g: Small proteins [56992] (92 folds) |
![]() | Fold g.17: Cystine-knot cytokines [57500] (1 superfamily) disulfide-rich fold; common core is all-beta |
![]() | Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) ![]() |
![]() | Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins) |
![]() | Protein automated matches [190307] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187121] (8 PDB entries) |
![]() | Domain d2gooa_: 2goo A: [135441] Other proteins in same PDB: d2goob_, d2gooc_, d2gooe_, d2goof_ automated match to d3bmpa_ complexed with ndg |
PDB Entry: 2goo (more details), 2.2 Å
SCOPe Domain Sequences for d2gooa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gooa_ g.17.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ssckrhplyvdfsdvgwndwivappgyhafychgecpfpladhlnstnhaivqtlvnsvn skipkaccvptelsaismlyldenekvvlknyqdmvvegcgcr
Timeline for d2gooa_: