![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
![]() | Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) ![]() |
![]() | Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins) |
![]() | Protein HIV-1 capsid protein [47945] (1 species) |
![]() | Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (12 PDB entries) |
![]() | Domain d2gold1: 2gol D:144-278 [135440] Other proteins in same PDB: d2gola1 automatically matched to d1l6na2 complexed with so4 |
PDB Entry: 2gol (more details), 2.2 Å
SCOP Domain Sequences for d2gold1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gold1 a.73.1.1 (D:144-278) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]} hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke tineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk rwiilglnkivrmys
Timeline for d2gold1: