SCOPe 2.07: Domain d2golb_: 2gol B:

Lineage for d2golb_ (2gol B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (70 PDB entries)

8. Domain d2golb_: 2gol B: [135439]
   Other proteins in same PDB: d2gola_
   automated match to d1afva_
   complexed with so4

Details for d2golb_

PDB Entry: 2gol, 2.2 Å

PDB Description: Xray Structure of Gag278

PDB Compounds: (B:) Capsid protein p24 (CA)

SCOPe Domain Sequences for d2golb_:

Sequence; same for both SEQRES and ATOM records:

>d2golb_ a.73.1.1 (B:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmys

Timeline for d2golb_:

• d2golb_ first appeared in SCOP 1.73, called d2golb1
  
• d2golb_ appears in SCOPe 2.06
  
• d2golb_ appears in the current release, SCOPe 2.08