SCOP 1.75: Domain d2golb1: 2gol B:144-278

Lineage for d2golb1 (2gol B:144-278)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)

6. Protein HIV-1 capsid protein [47945] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (15 PDB entries)

8. Domain d2golb1: 2gol B:144-278 [135439]
   Other proteins in same PDB: d2gola1
   automatically matched to d1l6na2
   complexed with so4

Details for d2golb1

PDB Entry: 2gol, 2.2 Å

PDB Description: Xray Structure of Gag278

PDB Compounds: (B:) Capsid protein p24 (CA)

SCOP Domain Sequences for d2golb1:

Sequence; same for both SEQRES and ATOM records:

>d2golb1 a.73.1.1 (B:144-278) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmys

Timeline for d2golb1:

• d2golb1 first appeared in SCOP 1.73
  
• d2golb1 is called d2golb_ in SCOPe 2.01
  
• d2golb1 appears in the current release, SCOPe 2.08, called d2golb_