Lineage for d2golb1 (2gol B:144-278)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643989Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 643990Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 643991Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)
  6. 644005Protein HIV-1 capsid protein [47945] (1 species)
  7. 644006Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (12 PDB entries)
  8. 644023Domain d2golb1: 2gol B:144-278 [135439]
    Other proteins in same PDB: d2gola1
    automatically matched to d1l6na2
    complexed with so4

Details for d2golb1

PDB Entry: 2gol (more details), 2.2 Å

PDB Description: Xray Structure of Gag278
PDB Compounds: (B:) Capsid protein p24 (CA)

SCOP Domain Sequences for d2golb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2golb1 a.73.1.1 (B:144-278) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmys

SCOP Domain Coordinates for d2golb1:

Click to download the PDB-style file with coordinates for d2golb1.
(The format of our PDB-style files is described here.)

Timeline for d2golb1: