![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.6: beta-Phosphoglucomutase-like [75173] (10 proteins) the insertion subdomain is a 4-helical bundle |
![]() | Protein Hypothetical protein SP2064 [142139] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142140] (1 PDB entry) Uniprot Q97NG6 3-206 |
![]() | Domain d2go7d_: 2go7 D: [135437] Other proteins in same PDB: d2go7c3 automated match to d2go7a1 complexed with cl, mg |
PDB Entry: 2go7 (more details), 2.1 Å
SCOPe Domain Sequences for d2go7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2go7d_ c.108.1.6 (D:) Hypothetical protein SP2064 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} ktafiwdldgtlldsyeailsgieetfaqfsipydkekvrefifkysvqdllvrvaedrn ldvevlnqvraqslaeknaqvvlmpgarevlawadesgiqqfiythkgnnaftilkdlgv esyfteiltsqsgfvrkpspeaatylldkyqlnsdntyyigdrtldvefaqnsgiqsinf lestyegnhriqaladisrifet
Timeline for d2go7d_:
![]() Domains from other chains: (mouse over for more information) d2go7a1, d2go7b_, d2go7c2, d2go7c3 |